{"product_id":"proteintech-67957-1-ig","title":"Proteintech, 67957-1-Ig, CLN3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLN3 (67957-1-Ig) by Proteintech is a Monoclonal antibody targeting CLN3 in WB, ELISA applications with reactivity to Human samples\n67957-1-Ig targets CLN3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  NCCIT cells,  NCI-H1299 cells,  A549 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuronal ceroid lipofuscinosis (NCL, or Batten disease) refers to a group of lethal pediatric neurodegenerative diseases originating from mutations in one of the thus far identified 13 CLN genes (Ceroid Lipofuscinosis, Neuronal type; CLN1 to CLN14) (PMID: 25051496). CLN3 is a multi-membrane-spanning protein involved in the microtubule-dependent, anterograde transport of late endosomes and lysosomes. The CLN3 gene is located on chromosome 16p12.1 and produces three mRNA splicing variants. The 438-amino-acid CLN3 protein has a calculated molecular weight of 48 kDa. It has been reported that CLN3 can be glycosylated and form a homodimeric complex (PMID: 10356317; 17286803).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31402 Product name: Recombinant human CLN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 300-438 aa of BC002394 Sequence: QGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS Predict reactive species\nFull Name: ceroid-lipofuscinosis, neuronal 3\nCalculated Molecular Weight: 438 aa, 48 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC002394\nGene Symbol: CLN3\nGene ID (NCBI): 1201\nRRID: AB_2918708\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13286\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888109834409,"sku":"67957-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67957-1-ig","provider":"Iright","version":"1.0","type":"link"}