{"product_id":"proteintech-67990-1-ig","title":"Proteintech, 67990-1-Ig, MMP7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP7 (67990-1-Ig) by Proteintech is a Monoclonal antibody targeting MMP7 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n67990-1-Ig targets MMP7 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, HT-29 cells,  COLO 320 cells,  A549 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human pancreas cancer tissue\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species\nFull Name: matrix metallopeptidase 7 (matrilysin, uterine)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC003635\nGene Symbol: MMP7\nGene ID (NCBI): 4316\nRRID: AB_2918739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09237\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888030437545,"sku":"67990-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67990-1-ig","provider":"Iright","version":"1.0","type":"link"}