{"product_id":"proteintech-67993-1-ig","title":"Proteintech, 67993-1-Ig, SLC30A2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC30A2 (67993-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC30A2 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n67993-1-Ig targets SLC30A2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HaCaT cells,  Caco-2 cells,  HT-29 cells,  HeLa cells,  NCCIT cells,  JAR cells,  ATDC-5 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species\nFull Name: solute carrier family 30 (zinc transporter), member 2\nCalculated Molecular Weight: 323 aa, 35 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC006251\nGene Symbol: SLC30A2\nGene ID (NCBI): 7780\nRRID: AB_2918742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BRI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049672361,"sku":"67993-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67993-1-ig","provider":"Iright","version":"1.0","type":"link"}