{"product_id":"proteintech-68025-1-ig","title":"Proteintech, 68025-1-Ig, SLC39A3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A3 (68025-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC39A3 in WB, ELISA applications with reactivity to Human samples\n68025-1-Ig targets SLC39A3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled HepG2 cells, HepG2 cells,  37°C incubated A549 cells,  LNCaP cells,  Jurkat cells,  K-562 cells,  unboiled A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A3, also named as ZIP3, belongs to the ZIP transporter (TC 2.A.5) family. SLC39A3 is a Zn importer that acts as a zinc-influx transporter. SLC39A3 is highly expressed in a cell-type-specific manner in ovaries, testes, and the developing nervous system with limited expression in the small intestinal crypt cells, kidney glomerulus, and discrete regions of the liver. SLC39A3 is also expressed in highly specialized, hormonally responsive secretory tissues, such as the pancreas, prostate, and mammary gland (PMID: 19458277). SLC39A3 has 2 isoforms with the molecular mass of 11 and 34 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14289 Product name: Recombinant human SLC39A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-180 aa of BC005869 Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 3\nCalculated Molecular Weight: 314 aa, 34 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC005869\nGene Symbol: SLC39A3\nGene ID (NCBI): 29985\nRRID: AB_2918769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BRY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324792489,"sku":"68025-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68025-1-ig","provider":"Iright","version":"1.0","type":"link"}