{"product_id":"proteintech-68032-1-ig","title":"Proteintech, 68032-1-Ig, DUSP22 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP22 (68032-1-Ig) by Proteintech is a Monoclonal antibody targeting DUSP22 in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit samples\n68032-1-Ig targets DUSP22 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rabbit brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Rabbit\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9831 Product name: Recombinant human DUSP22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC022847 Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL Predict reactive species\nFull Name: dual specificity phosphatase 22\nCalculated Molecular Weight: 184 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC022847\nGene Symbol: DUSP22\nGene ID (NCBI): 56940\nRRID: AB_2918774\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888273281193,"sku":"68032-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68032-1-ig","provider":"Iright","version":"1.0","type":"link"}