{"product_id":"proteintech-68052-1-ig","title":"Proteintech, 68052-1-Ig, RAB3A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3A (68052-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB3A in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples\n68052-1-Ig targets RAB3A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue,  rabbit cerebellum tissue,  rat cerebellum tissue\nPositive IHC detected in: rat testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal\/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3a is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and\/ or by recruiting regulatory molecules to the docking\/ fusion machinery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit, chicken\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8148 Product name: Recombinant human RAB3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-220 aa of BC011782 Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC Predict reactive species\nFull Name: RAB3A, member RAS oncogene family\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC011782\nGene Symbol: RAB3A\nGene ID (NCBI): 5864\nRRID: AB_2918794\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20336\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888072839337,"sku":"68052-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68052-1-ig","provider":"Iright","version":"1.0","type":"link"}