{"product_id":"proteintech-68095-1-ig","title":"Proteintech, 68095-1-Ig, SNRPB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPB2 (68095-1-Ig) by Proteintech is a Monoclonal antibody targeting SNRPB2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n68095-1-Ig targets SNRPB2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  K-562 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nU2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5540 Product name: Recombinant human SNRPB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC036737 Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide B''\nCalculated Molecular Weight: 225 aa, 26, 5 kDa\nObserved Molecular Weight: 25-31 kDa\nGenBank Accession Number: BC036737\nGene Symbol: SNRPB2\nGene ID (NCBI): 6629\nRRID: AB_2918832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08579\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888325611689,"sku":"68095-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68095-1-ig","provider":"Iright","version":"1.0","type":"link"}