{"product_id":"proteintech-68100-1-ig","title":"Proteintech, 68100-1-Ig, p115, USO1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe p115, USO1 (68100-1-Ig) by Proteintech is a Monoclonal antibody targeting p115, USO1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68100-1-Ig targets p115, USO1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\np115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5543 Product name: Recombinant human p115, USO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 660-961 aa of BC032654 Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI Predict reactive species\nFull Name: USO1 homolog, vesicle docking protein (yeast)\nCalculated Molecular Weight: 962 aa, 108 kDa\nObserved Molecular Weight: 108 kDa\nGenBank Accession Number: BC032654\nGene Symbol: USO1\nGene ID (NCBI): 8615\nRRID: AB_2918835\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888307949737,"sku":"68100-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68100-1-ig","provider":"Iright","version":"1.0","type":"link"}