{"product_id":"proteintech-68110-1-ig","title":"Proteintech, 68110-1-Ig, RPL12 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPL12 (68110-1-Ig) by Proteintech is a Monoclonal antibody targeting RPL12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n68110-1-Ig targets RPL12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse brain tissue, human endometrial cancer tissue,  human placenta tissue,  mouse stomach tissue,  rat brain tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:8000-1:32000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6580 Product name: Recombinant human RPL12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC050644 Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS Predict reactive species\nFull Name: ribosomal protein L12\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC050644\nGene Symbol: RPL12\nGene ID (NCBI): 6136\nRRID: AB_2923639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P30050\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888320041129,"sku":"68110-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68110-1-ig","provider":"Iright","version":"1.0","type":"link"}