{"product_id":"proteintech-68116-1-ig","title":"Proteintech, 68116-1-Ig, PGAM5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGAM5 (68116-1-Ig) by Proteintech is a Monoclonal antibody targeting PGAM5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68116-1-Ig targets PGAM5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, rabbit brain tissue,  pig brain tissue,  HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphoglycerate mutase 5 (PGAM5) is a mitochondrial Serine (Ser)\/Threonine (Thr) phosphatase normally located in the inner mitochondrial membrane. Upon mitochondrial dysfunction, PGAM5 recruits and dephosphorylates Drp1 at Ser-637, triggers its GTPase activity and promotes mitochondrial fission. PGAM5 regulates mitophagy by stabilizing PINK1 under stress conditions, which recruits E3 ubiquitin ligase PARKIN for degradation of the damaged mitochondria. PGAM5 can be cleaved and released to the cytoplasm through PARKIN, which activates Wnt signaling and induces mitochondrial biogenesis (PMID: 32439975). PGAM5 has 2 isoforms with the molecular mass of 28 and 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28195 Product name: Recombinant human PGAM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC008196 Sequence: MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVVLGS Predict reactive species\nFull Name: phosphoglycerate mutase family member 5\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC008196\nGene Symbol: PGAM5\nGene ID (NCBI): 192111\nRRID: AB_2923645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96HS1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888031617193,"sku":"68116-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68116-1-ig","provider":"Iright","version":"1.0","type":"link"}