{"product_id":"proteintech-68118-1-ig","title":"Proteintech, 68118-1-Ig, BNIP3L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BNIP3L (68118-1-Ig) by Proteintech is a Monoclonal antibody targeting BNIP3L in WB, IHC, ELISA applications with reactivity to human, rat samples\n68118-1-Ig targets BNIP3L in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, LNCaP cells,  HeLa cells,  Jurkat cells,  MOLT-4 cells,  K-562 cells,  Raji cells\nPositive IHC detected in: rat kidney tissue, human prostate cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBNIP3L\/Nix is a mitochondrial protein from the outer membrane that belongs to the BH3-only protein from the BCL2 family. BNIP3L was initially recognized as a proapoptotic protein with milder efficacy in inducing apoptosis compared to other proteins in this family. These phenotypes raised concerns about the molecular function of BNIP3L besides inducing apoptosis. Moreover, studies have shown that BNIP3L is a 24-kDa protein, which is predominantly expressed as a 48-kDa dimer. When analyzed by SDS-PAGE, BNIP3 migrates predominantly as a about 60 kDa dimer in addition to the 30 kDa monomer. (PMID: 34930907, PMID: 32286918)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31547 Product name: Recombinant human BNIP3L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species\nFull Name: BCL2\/adenovirus E1B 19kDa interacting protein 3-like\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 35 kD\nGenBank Accession Number: BC001559\nGene Symbol: BNIP3L\nGene ID (NCBI): 665\nRRID: AB_2923647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O60238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009302185,"sku":"68118-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68118-1-ig","provider":"Iright","version":"1.0","type":"link"}