{"product_id":"proteintech-68181-1-ig","title":"Proteintech, 68181-1-Ig, COMT Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe COMT (68181-1-Ig) by Proteintech is a Monoclonal antibody targeting COMT in WB, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n68181-1-Ig targets COMT in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293 cells,  K-562 cells,  pig adrenal gland tissue,  human testis tissue,  rat testis tissue,  mouse testis tissue\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCatechol O-methyltransferase (COMT) is an important enzyme that catalyzes O-methylation and inactivation of metabolically active catechol-containing bioactive molecules and drugs. The mammalian COMT enzyme exists in soluble form (24-26 kDa) and membrane-bound form (28-30 kDa), which are encoded by a single gene utilizing different promoters.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6502 Product name: Recombinant human COMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000419 Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP Predict reactive species\nFull Name: catechol-O-methyltransferase\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC000419\nGene Symbol: COMT\nGene ID (NCBI): 1312\nRRID: AB_2935272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P21964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888110948521,"sku":"68181-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68181-1-ig","provider":"Iright","version":"1.0","type":"link"}