{"product_id":"proteintech-68186-1-ig","title":"Proteintech, 68186-1-Ig, ARL8A\/ARL8B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL8A\/ARL8B (68186-1-Ig) by Proteintech is a Monoclonal antibody targeting ARL8A\/ARL8B in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, rabbit samples\n68186-1-Ig targets ARL8A\/ARL8B in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, LNCaP cells,  human placenta tissue,  HeLa cells,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: A549 cells, C6 cells,  Neuro-2a cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A\/ARL8B can be recognized by this antibody.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10758 Product name: Recombinant human ARL8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC015408 Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Predict reactive species\nFull Name: ADP-ribosylation factor-like 8A\nCalculated Molecular Weight: 186 aa, 21 kDa\nObserved Molecular Weight: 18 kDa, 21 kDa\nGenBank Accession Number: BC015408\nGene Symbol: ARL8A\nGene ID (NCBI): 127829\nRRID: AB_3085047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96BM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888099971241,"sku":"68186-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68186-1-ig","provider":"Iright","version":"1.0","type":"link"}