{"product_id":"proteintech-68196-1-ig","title":"Proteintech, 68196-1-Ig, PHF5A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF5A (68196-1-Ig) by Proteintech is a Monoclonal antibody targeting PHF5A in WB, ELISA applications with reactivity to Human, mouse samples\n68196-1-Ig targets PHF5A in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, NIH\/3T3 cells,  HeLa cells,  HepG2 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1\/Cx43 promoter and enhancing its up-regulation by ESR1\/ER-alpha and is involved in pre-mRNA splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7804 Product name: Recombinant human INI-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC007321 Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR Predict reactive species\nFull Name: PHD finger protein 5A\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC007321\nGene Symbol: PHF5A\nGene ID (NCBI): 84844\nRRID: AB_2935285\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q7RTV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888309981353,"sku":"68196-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68196-1-ig","provider":"Iright","version":"1.0","type":"link"}