{"product_id":"proteintech-68211-1-ig","title":"Proteintech, 68211-1-Ig, Integrin alpha 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin alpha 1 (68211-1-Ig) by Proteintech is a Monoclonal antibody targeting Integrin alpha 1 in WB, IF-P, ELISA applications with reactivity to human samples\n68211-1-Ig targets Integrin alpha 1 in WB, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human placenta tissue\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-1 (ITGA1, CD49a) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor for collagen and laminin. This receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. Integrin alpha-1 is a transmembrane glycoprotein with an apparent molecular weight of 180-250 kDa, larger than the calculated molecular weight of 131 kDa (PMID: 2475259; 3257425; 11557277; 18840653).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30631 Product name: Recombinant human Integrin alpha-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 980-1141 aa of BC137121 Sequence: GNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVP Predict reactive species\nFull Name: integrin, alpha 1\nCalculated Molecular Weight: 1179 aa, 131 kDa\nObserved Molecular Weight: 180 kDa\nGenBank Accession Number: BC137121\nGene Symbol: Integrin alpha 1\nGene ID (NCBI): 3672\nRRID: AB_2935299\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56199\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888287273129,"sku":"68211-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68211-1-ig","provider":"Iright","version":"1.0","type":"link"}