{"product_id":"proteintech-68217-1-ig","title":"Proteintech, 68217-1-Ig, eRF3a\/GSPT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe eRF3a\/GSPT1 (68217-1-Ig) by Proteintech is a Monoclonal antibody targeting eRF3a\/GSPT1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n68217-1-Ig targets eRF3a\/GSPT1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, COLO 320 cells,  HepG2 cells,  pig brain tissue,  LNCaP cells,  HeLa cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: HepG2 cells, PC-3 cells,  HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a\/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a\/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1\/eRF3a protein, lacking the first 69 residues(PMID: 12865429).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27986 Product name: Recombinant human GSPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 294-499 aa of BC009503 Sequence: FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD Predict reactive species\nFull Name: G1 to S phase transition 1\nCalculated Molecular Weight: 68 aa, 4 kDa\nObserved Molecular Weight: 80-85 kDa\nGenBank Accession Number: BC009503\nGene Symbol: GSPT1\nGene ID (NCBI): 2935\nRRID: AB_2935305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15170\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888027783337,"sku":"68217-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68217-1-ig","provider":"Iright","version":"1.0","type":"link"}