{"product_id":"proteintech-68218-1-ig","title":"Proteintech, 68218-1-Ig, CD163 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD163 (68218-1-Ig) by Proteintech is a Monoclonal antibody targeting CD163 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples\n68218-1-Ig targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human liver tissue, human appendicitis tissue,  human lung cancer tissue,  human placenta tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma\/serum marker for macrophage activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26721 Product name: Recombinant human CD163 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 46-401 aa of BC051281 Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG Predict reactive species\nFull Name: CD163 molecule\nCalculated Molecular Weight: 1156 aa, 125 kDa\nObserved Molecular Weight: 145-150 kDa\nGenBank Accession Number: BC051281\nGene Symbol: CD163\nGene ID (NCBI): 9332\nENSEMBL Gene ID: ENSG00000177575\nRRID: AB_2935306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q86VB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887997702313,"sku":"68218-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68218-1-ig","provider":"Iright","version":"1.0","type":"link"}