{"product_id":"proteintech-68242-1-ig","title":"Proteintech, 68242-1-Ig, GLO1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLO1 (68242-1-Ig) by Proteintech is a Monoclonal antibody targeting GLO1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n68242-1-Ig targets GLO1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, LNCaP cells,  Jurkat cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlo1 (glyxoalase I) is a cytosolic protein expressed in all mammalian cells. Its physiological function is the detoxification of MG (methylglyoxal), which is a potent precursor of AGEs (advanced glycation end-products). Glo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7314 Product name: Recombinant human GLO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC001741 Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM Predict reactive species\nFull Name: glyoxalase I\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC001741\nGene Symbol: GLO1\nGene ID (NCBI): 2739\nRRID: AB_2935329\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q04760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888280424617,"sku":"68242-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68242-1-ig","provider":"Iright","version":"1.0","type":"link"}