{"product_id":"proteintech-68284-1-ig","title":"Proteintech, 68284-1-Ig, NEUROD2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEUROD2 (68284-1-Ig) by Proteintech is a Monoclonal antibody targeting NEUROD2 in WB, ELISA applications with reactivity to Human, mouse, pig samples\n68284-1-Ig targets NEUROD2 in WB, ELISA applications and shows reactivity with Human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, mouse cerebellum tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  pig cerebellum tissue,  rabbit cerebellum tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEUROD2 (Neurogenic differentiation factor 2), is transcriptional regulator that regulates early neuronal differentiation during development (PMID: 7754368). NeuroD2 is expressed in the postnatal cortex and mediate the activity-dependent refinement of thalamocortical axon terminals (PMID: 17453014). NeuroD2 is mainly involved in the development of the cerebellar and hippocampal granular neurons, neurons in the basolateral nucleus of amygdala and the hypothalamic-pituitary axis.  Mutantions in NEUROD2 can cause neurodevelopmental disorders including intellectual disability and autism spectrum disorders (PMID: 34188164).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26068 Product name: Recombinant human NEUROD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 314-382 aa of BC022481 Sequence: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN Predict reactive species\nFull Name: neurogenic differentiation 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41-50 kDa\nGenBank Accession Number: BC022481\nGene Symbol: NEUROD2\nGene ID (NCBI): 4761\nRRID: AB_2935365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q15784\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302805161,"sku":"68284-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68284-1-ig","provider":"Iright","version":"1.0","type":"link"}