{"product_id":"proteintech-68312-1-ig","title":"Proteintech, 68312-1-Ig, DYNLT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNLT1 (68312-1-Ig) by Proteintech is a Monoclonal antibody targeting DYNLT1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68312-1-Ig targets DYNLT1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IF\/ICC detected in: H9C2 cells, C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (PMID: 19448628)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33072 Product name: Recombinant human DYNLT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI Predict reactive species\nFull Name: dynein, light chain, Tctex-type 1\nCalculated Molecular Weight: 113 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC029412\nGene Symbol: DYNLT1\nGene ID (NCBI): 6993\nRRID: AB_2935390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P63172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888273313961,"sku":"68312-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68312-1-ig","provider":"Iright","version":"1.0","type":"link"}