{"product_id":"proteintech-68323-1-ig","title":"Proteintech, 68323-1-Ig, LRRC8C Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC8C (68323-1-Ig) by Proteintech is a Monoclonal antibody targeting LRRC8C in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n68323-1-Ig targets LRRC8C in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  HEK-239 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRRC8C (Leucine-rich repeat-containing protein 8C), also known as AD158, is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel), which is required to maintain a constant cell volume in response to extracellular or intracellular permeability changes. The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine. The VRAC channel also mediates transport of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol (PMID:24790029; 26824658; 28193731).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17001 Product name: Recombinant human LRRC8C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 618-803 aa of BC113973 Sequence: DLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETLPSDVREQMKTE Predict reactive species\nFull Name: leucine rich repeat containing 8 family, member C\nCalculated Molecular Weight: 803 aa, 92 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC113973\nGene Symbol: LRRC8C\nGene ID (NCBI): 84230\nRRID: AB_2935395\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TDW0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888290386089,"sku":"68323-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68323-1-ig","provider":"Iright","version":"1.0","type":"link"}