{"product_id":"proteintech-68325-1-ig","title":"Proteintech, 68325-1-Ig, SH3GLB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH3GLB2 (68325-1-Ig) by Proteintech is a Monoclonal antibody targeting SH3GLB2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68325-1-Ig targets SH3GLB2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, MCF-7 cells,  rat brain tissue,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  pig brain tissue,  rabbit brain tissue,  mouse brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH3GLB2 is an endophilin-related protein family with 395-amino acid protein and contains an N-terminal domain, a central coiled-coil region, and a C-terminal SH3 domain. SH3GLB2 is expressed in many tissues, including skeletal muscle, adipocytes, brain, lung, colon, and mammary gland. SH3GLB2 was expressed in the cytoplasm of transfected HeLa cells and was excluded from nuclei(PMID: 11161816).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8932 Product name: Recombinant human SH3GLB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-395 aa of BC014635 Sequence: MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS Predict reactive species\nFull Name: SH3-domain GRB2-like endophilin B2\nCalculated Molecular Weight: 395 aa, 44 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC014635\nGene Symbol: SH3GLB2\nGene ID (NCBI): 56904\nRRID: AB_2935397\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NR46\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323547305,"sku":"68325-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68325-1-ig","provider":"Iright","version":"1.0","type":"link"}