{"product_id":"proteintech-68334-1-ig","title":"Proteintech, 68334-1-Ig, CC2D1A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CC2D1A (68334-1-Ig) by Proteintech is a Monoclonal antibody targeting CC2D1A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68334-1-Ig targets CC2D1A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HEK-293 cells,  LNCaP cells,  HeLa cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCC2D1A (coiled-coil and C2 domain-containing 1A), also known as Freud-1, Aki1 or TAPE (TBK1-associated protein in endolysosomes), is a evolutionary conserved protein located in different subcellular compartments, including the nucleus, centrosome, and endolysosomes. It acts as a scaffold protein that interacts with various proteins and plays diverse biological roles. Mutations in CC2D1A have been linked to nonsyndromic mental retardation (NMSR) and generate a truncated 85-kDa product. Several isoforms of CC2D1A proteins have also been described: 120 \/130-kDa doublet of long isoform and 67 kDa short isoform. The short isoform of CC2D1A has been identified as the predominant isoform in rodent cells, while the long isoform is more abundant in human cells. Recently it has been reported that CC2D1A\/TAPE is the first innate immune regulator implicated in both TLR and RLR signaling at a very early step.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10363 Product name: Recombinant human CC2D1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC064981 Sequence: MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEA Predict reactive species\nFull Name: coiled-coil and C2 domain containing 1A\nCalculated Molecular Weight: 951 aa, 104 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC064981\nGene Symbol: CC2D1A\nGene ID (NCBI): 54862\nRRID: AB_3085058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6P1N0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888104984745,"sku":"68334-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68334-1-ig","provider":"Iright","version":"1.0","type":"link"}