{"product_id":"proteintech-68337-1-ig","title":"Proteintech, 68337-1-Ig, THYN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe THYN1 (68337-1-Ig) by Proteintech is a Monoclonal antibody targeting THYN1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n68337-1-Ig targets THYN1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, U2OS cells,  HeLa cells,  HepG2 cells,  K-562 cells,  Jurkat cells,  MOLT-4 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHYN1, also named as THY28, is a 28-32 kDa protein which located mainly in the nucleus. It appears to correlate with induction of apoptosis. (PMID:14601557)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8617 Product name: Recombinant human THYN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-166 aa of BC006978 Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILF Predict reactive species\nFull Name: thymocyte nuclear protein 1\nCalculated Molecular Weight: 225aa,26 kDa; 166aa,19 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC006978\nGene Symbol: THYN1\nGene ID (NCBI): 29087\nRRID: AB_3085061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9P016\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330854569,"sku":"68337-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68337-1-ig","provider":"Iright","version":"1.0","type":"link"}