{"product_id":"proteintech-68344-1-ig","title":"Proteintech, 68344-1-Ig, SMNDC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMNDC1 (68344-1-Ig) by Proteintech is a Monoclonal antibody targeting SMNDC1 in WB, FC (Intra), ELISA applications with reactivity to human samples\n68344-1-Ig targets SMNDC1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  Daudi cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSurvival motor neuron domain-containing protein 1 (SMNDC1), also known as survival of motor neuron-related-splicing factor 30 (SPF30) or SMN-related protein (SMNR), is a constituent of the spliceosome complex that plays an essential role in spliceosome assembly by recruiting U4\/U5\/U6 tri-snRNP to the pre-spliceosomal complex (PMID: 9817934; 11331595; 30904945). Both SMNDC1 and SMN1 contain a highly conserved central Tudor domain which functions as a protein-protein interaction surface and mediates binding to the spliceosomal Sm proteins (PMID: 11331595).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33140 Product name: Recombinant human SMNDC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC011234 Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ Predict reactive species\nFull Name: survival motor neuron domain containing 1\nCalculated Molecular Weight: 238 aa, 27 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC011234\nGene Symbol: SMNDC1\nGene ID (NCBI): 10285\nRRID: AB_3085068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75940\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888076083369,"sku":"68344-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68344-1-ig","provider":"Iright","version":"1.0","type":"link"}