{"product_id":"proteintech-68351-1-ig","title":"Proteintech, 68351-1-Ig, ATPAF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATPAF2 (68351-1-Ig) by Proteintech is a Monoclonal antibody targeting ATPAF2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n68351-1-Ig targets ATPAF2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, LNCaP cells,  MCF-7 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 68351-1-Ig can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29065 Product name: Recombinant human ATPAF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 42-192 aa of BC032126 Sequence: PPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVL Predict reactive species\nFull Name: ATP synthase mitochondrial F1 complex assembly factor 2\nCalculated Molecular Weight: 289 aa, 33 kDa\nObserved Molecular Weight: ~30 kDa\nGenBank Accession Number: BC032126\nGene Symbol: ATPAF2\nGene ID (NCBI): 91647\nRRID: AB_3085074\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8N5M1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888101445801,"sku":"68351-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68351-1-ig","provider":"Iright","version":"1.0","type":"link"}