{"product_id":"proteintech-68404-1-ig","title":"Proteintech, 68404-1-Ig, NPHP5\/IQCB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPHP5\/IQCB1 (68404-1-Ig) by Proteintech is a Monoclonal antibody targeting NPHP5\/IQCB1 in WB, ELISA applications with reactivity to Human samples\n68404-1-Ig targets NPHP5\/IQCB1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, A431 cells,  HT-1376 cells,  Saos-2 cells,  MDA-MB-468 cells,  HEK-293 cells,  COLO 320 cells,  HL-60 cells,  Daudi cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIQCB1, also known as NPHP5, is a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. It has a central coiled-coil region and two calmodulin-binding IQ domains. Localized to the primary cilia of renal epithelial cells and connecting cilia of photoreceptor cells, IQCB1 is thought to play a role in ciliary function.  Mutations in this gene result in Senior-Loken syndrome type 5, a juvenile disorder characterized by defects in the waste filtering system of the kidney, as well as retinal degradation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8203 Product name: Recombinant human NPHP5,IQCB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC005806 Sequence: MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKYRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELH Predict reactive species\nFull Name: IQ motif containing B1\nCalculated Molecular Weight: 598 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC005806\nGene Symbol: IQCB1\nGene ID (NCBI): 9657\nRRID: AB_3085121\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15051\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888306311337,"sku":"68404-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68404-1-ig","provider":"Iright","version":"1.0","type":"link"}