{"product_id":"proteintech-68433-1-ig","title":"Proteintech, 68433-1-Ig, Centrin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Centrin 1 (68433-1-Ig) by Proteintech is a Monoclonal antibody targeting Centrin 1 in IF\/ICC, ELISA applications with reactivity to Human samples\n68433-1-Ig targets Centrin 1 in IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: hTERT-RPE1 cells, ARPE-19 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3529 Product name: Recombinant human CETN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC029515 Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY Predict reactive species\nFull Name: centrin, EF-hand protein, 1\nCalculated Molecular Weight: 172 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC029515\nGene Symbol: Centrin 1\nGene ID (NCBI): 1068\nRRID: AB_3085147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q12798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888058552489,"sku":"68433-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68433-1-ig","provider":"Iright","version":"1.0","type":"link"}