{"product_id":"proteintech-68437-1-ig","title":"Proteintech, 68437-1-Ig, HDAC5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC5 (68437-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC5 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68437-1-Ig targets HDAC5 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells, COLO 320 cells,  HeLa cells,  T-47D cells,  SK-BR-3 cells,  A2780 cells,  HepG2 cells,  HSC-T6 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30557 Product name: Recombinant human HDAC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 371-513 aa of NM_005474 Sequence: NISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVM Predict reactive species\nFull Name: histone deacetylase 5\nCalculated Molecular Weight: 122 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_005474\nGene Symbol: HDAC5\nGene ID (NCBI): 10014\nRRID: AB_3085150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UQL6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888282456233,"sku":"68437-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68437-1-ig","provider":"Iright","version":"1.0","type":"link"}