{"product_id":"proteintech-68438-1-ig","title":"Proteintech, 68438-1-Ig, BIK Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BIK (68438-1-Ig) by Proteintech is a Monoclonal antibody targeting BIK in WB, ELISA applications with reactivity to Human samples\n68438-1-Ig targets BIK in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW480 cells, Caco-2 cells,  THP-1 cells,  Raji cells,  Daudi cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6353 Product name: Recombinant human BIK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-134 aa of BC001599 Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCE Predict reactive species\nFull Name: BCL2-interacting killer (apoptosis-inducing)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC001599\nGene Symbol: BIK\nGene ID (NCBI): 638\nRRID: AB_3085151\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13323\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056750249,"sku":"68438-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68438-1-ig","provider":"Iright","version":"1.0","type":"link"}