{"product_id":"proteintech-68464-1-ig","title":"Proteintech, 68464-1-Ig, TEAD3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TEAD3 (68464-1-Ig) by Proteintech is a Monoclonal antibody targeting TEAD3 in WB, IF-P, ELISA applications with reactivity to human, pig samples\n68464-1-Ig targets TEAD3 in WB, IF-P, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, JAR cells,  HepG2 cells,  U2OS cells,  pig heart tissue\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEAD3, others named transcription enhancer factor 5(TEF5), is a member of the family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involvement in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA\/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in the placenta and choriocarcinoma cells(JEG-3) but is low in Hela, HepG2, and MCF-7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4407 Product name: Recombinant human TEAD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-324 aa of BC027877 Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD Predict reactive species\nFull Name: TEA domain family member 3\nCalculated Molecular Weight: 435 aa, 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC027877\nGene Symbol: TEAD3\nGene ID (NCBI): 7005\nRRID: AB_3085175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q99594\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330035369,"sku":"68464-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68464-1-ig","provider":"Iright","version":"1.0","type":"link"}