{"product_id":"proteintech-68476-1-ig","title":"Proteintech, 68476-1-Ig, LPCAT2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPCAT2 (68476-1-Ig) by Proteintech is a Monoclonal antibody targeting LPCAT2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68476-1-Ig targets LPCAT2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, A375 cells,  A549 cells,  HEK-293 cells,  HT-29 cells,  Jurkat cells,  HL-60 cells,  HSC-T6 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLPCAT2 (Lysophosphatidylcholine acyltransferase 2) is also named as AGPAT11 and AYTL1. Lipid droplet (LD) content of CRC cells positively correlates with the expression of lysophosphatidylcholine acyltransferase 2 (LPCAT2), an LD-localised enzyme supporting phosphatidylcholine synthesis (PMID: 29358673). Mitochondria play a significant role in ACSL4\/LPCAT2-driven ferroptosis (PMID: 3762584). In response to LPS, LPCAT2, but not LPCAT1, rapidly associates with TLR4 and translocates to membrane lipid raft domains to regulate macrophage inflammatory gene expression (PMID: 32587324).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26420 Product name: Recombinant human LPCAT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-544 aa of BC002472 Sequence: EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD Predict reactive species\nFull Name: lysophosphatidylcholine acyltransferase 2\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC002472\nGene Symbol: LPCAT2\nGene ID (NCBI): 54947\nRRID: AB_3085187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q7L5N7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888290320553,"sku":"68476-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68476-1-ig","provider":"Iright","version":"1.0","type":"link"}