{"product_id":"proteintech-68492-1-ig","title":"Proteintech, 68492-1-Ig, CIAPIN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIAPIN1 (68492-1-Ig) by Proteintech is a Monoclonal antibody targeting CIAPIN1 in WB, ELISA applications with reactivity to Human samples\n68492-1-Ig targets CIAPIN1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cytokine-induced anti-apoptotic molecule (CIAPIN1, or DRE2) had been found to be a differentially-expressed gene involved in a variety of cancers, and it was also considered as a candidate tumor suppressor gene in gastric cancer, renal cancer and liver cancer. CIAPIN1 plays an important role in the differentiation of colorectal cancer (CRC) cells, and the differential expression of CIAPIN1 in CRC was closely related to prognosis. CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a valuable prognostic indicator in esophageal squamous cell carcinoma (ESCC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33193 Product name: Recombinant human CIAPIN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC024196 Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA Predict reactive species\nFull Name: cytokine induced apoptosis inhibitor 1\nCalculated Molecular Weight: 312 aa, 34 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC024196\nGene Symbol: CIAPIN1\nGene ID (NCBI): 57019\nRRID: AB_3085203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6FI81\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888109473961,"sku":"68492-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68492-1-ig","provider":"Iright","version":"1.0","type":"link"}