{"product_id":"proteintech-68514-1-ig","title":"Proteintech, 68514-1-Ig, CDK5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK5 (68514-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n68514-1-Ig targets CDK5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, Caki-1 cells,  LNCaP cells,  SK-N-SH cells,  Jurkat cells,  Ramos cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine\/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28465 Product name: Recombinant human CDK5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-273 aa of BC005115 Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ Predict reactive species\nFull Name: cyclin-dependent kinase 5\nCalculated Molecular Weight: 31 kDa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC005115\nGene Symbol: CDK5\nGene ID (NCBI): 1020\nRRID: AB_3085223\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q00535\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107409577,"sku":"68514-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68514-1-ig","provider":"Iright","version":"1.0","type":"link"}