{"product_id":"proteintech-68540-1-ig","title":"Proteintech, 68540-1-Ig, SLC1A5\/ASCT2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC1A5\/ASCT2 (68540-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC1A5\/ASCT2 in WB, IHC, IF\/ICC, IF-Fro, FC (Intra), ELISA applications with reactivity to human samples\n68540-1-Ig targets SLC1A5\/ASCT2 in WB, IHC, IF\/ICC, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, PNGase F-treated A431 cells,  A549 cells,  PNGase F-treated A549 cells,  HT-29 cells,  PNGase F-treated HT-29 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: mouse small intestine tissue\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16837 Product name: Recombinant human RDRC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 436-541 aa of BC000062 Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM Predict reactive species\nFull Name: solute carrier family 1 (neutral amino acid transporter), member 5\nCalculated Molecular Weight: 541 aa, 57 kDa\nObserved Molecular Weight: 55-70 kDa\nGenBank Accession Number: BC000062\nGene Symbol: SLC1A5\/ASCT2\nGene ID (NCBI): 6510\nRRID: AB_3085248\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q15758\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324202665,"sku":"68540-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68540-1-ig","provider":"Iright","version":"1.0","type":"link"}