{"product_id":"proteintech-68552-1-ig","title":"Proteintech, 68552-1-Ig, RAB35 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB35 (68552-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB35 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit samples\n68552-1-Ig targets RAB35 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21424 Product name: Recombinant human RAB35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC015931 Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC Predict reactive species\nFull Name: RAB35, member RAS oncogene family\nCalculated Molecular Weight: 201 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC015931\nGene Symbol: RAB35\nGene ID (NCBI): 11021\nRRID: AB_3085256\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15286\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888316403881,"sku":"68552-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68552-1-ig","provider":"Iright","version":"1.0","type":"link"}