{"product_id":"proteintech-68555-1-ig","title":"Proteintech, 68555-1-Ig, PEX19 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEX19 (68555-1-Ig) by Proteintech is a Monoclonal antibody targeting PEX19 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n68555-1-Ig targets PEX19 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  HeLa cells,  A549 cells,  Jurkat cells,  K-562 cells,  Pig liver tissue,  Rat liver tissue,  Mouse liver tissue\nPositive IF\/ICC detected in: Jurkat cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. PEX19 gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) (PMID: 14709540). PEX19 may bind newly synthesized PMPs and facilitate their insertion into the peroxisome membrane (PMID: 107044440. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14) (PMID:20683989) (PMID:10051604).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6858 Product name: Recombinant human PEX19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC000496 Sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM Predict reactive species\nFull Name: peroxisomal biogenesis factor 19\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC000496\nGene Symbol: PEX19\nGene ID (NCBI): 5824\nRRID: AB_3085258\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P40855\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888309751977,"sku":"68555-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68555-1-ig","provider":"Iright","version":"1.0","type":"link"}