{"product_id":"proteintech-68615-1-ig","title":"Proteintech, 68615-1-Ig, SPIN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPIN1 (68615-1-Ig) by Proteintech is a Monoclonal antibody targeting SPIN1 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit samples\n68615-1-Ig targets SPIN1 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, NCCIT cells,  rabbit brain tissue,  SK-BR-3 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  rat brain tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K\/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33686 Product name: Recombinant human SPIN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-262 aa of BC013571 Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS Predict reactive species\nFull Name: spindlin 1\nCalculated Molecular Weight: 262 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013571\nGene Symbol: SPIN1\nGene ID (NCBI): 10927\nRRID: AB_3085309\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y657\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888326660265,"sku":"68615-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68615-1-ig","provider":"Iright","version":"1.0","type":"link"}