{"product_id":"proteintech-68823-1-ig","title":"Proteintech, 68823-1-Ig, DDAH1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDAH1 (68823-1-Ig) by Proteintech is a Monoclonal antibody targeting DDAH1 in WB, ELISA applications with reactivity to Human samples\n68823-1-Ig targets DDAH1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-3 cells, SH-SY5Y cells,  HT-29 cells,  SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDimethylarginine dimethylaminohydrolase 1 (DDAH1) is an enzyme that can degrade asymmetric dimethylarginine (ADMA), an endogenous nitric oxide synthase (NOS)inhibitor (PMID:26996393). About 80% of endogenous ADMA is metabolized by DDAH, principally the DDAH1 isoform (PMID:22460174). It was reported that DDAH1 is highly expressed in vascular endothelial cells in hearts (PMID:19917889). The observed molecular weight of DDAH1 is 35-40 kDa in the literature.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32840 Product name: Recombinant human DDAH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-285 aa of NM_012137 Sequence: VADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS Predict reactive species\nFull Name: dimethylarginine dimethylaminohydrolase 1\nCalculated Molecular Weight: 31kd\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: NM_012137\nGene Symbol: DDAH1\nGene ID (NCBI): 23576\nRRID: AB_3670434\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O94760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888247132329,"sku":"68823-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68823-1-ig","provider":"Iright","version":"1.0","type":"link"}