{"product_id":"proteintech-68923-1-ig","title":"Proteintech, 68923-1-Ig, THEM4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe THEM4 (68923-1-Ig) by Proteintech is a Monoclonal antibody targeting THEM4 in WB, ELISA applications with reactivity to human samples\n68923-1-Ig targets THEM4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HepG2 cells,  HeLa cells,  DU 145 cells,  LNCaP cells,  HEK-293 cells,  K-562 cells,  TF-1 cells,  HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHEM4, which stands for thioesterase superfamily member 4, is a gene in humans that encodes a protein involved in the regulation of the protein kinase B (PKB), also known as Akt pathway. This gene is ubiquitously expressed in various tissues, with notable expression in the kidney and testis. \nTHEM4 can also promote the proliferation of tumor cells by positively regulating Akt activity in breast cancer and nasopharyngeal carcinoma, which presents a contrasting role to its initial characterization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6296 Product name: Recombinant human THEM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-240 aa of BC065277 Sequence: MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT Predict reactive species\nFull Name: thioesterase superfamily member 4\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC065277\nGene Symbol: CTMP\nGene ID (NCBI): 117145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5T1C6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330657961,"sku":"68923-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68923-1-ig","provider":"Iright","version":"1.0","type":"link"}