{"product_id":"proteintech-68924-1-ig","title":"Proteintech, 68924-1-Ig, ARF6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARF6 (68924-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF6 in WB, ELISA applications with reactivity to human, pig samples\n68924-1-Ig targets ARF6 in WB, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  MCF-7 cells,  pig liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP\/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF6 is one of best identified ARFs  It is present at the plasma membrane and to some extent on endosomal membranes where it regulates the flow of trafficking into and out of the cell and the actin cytoskeleton. The antibody is specific to ARF6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12642 Product name: Recombinant human ARF6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 37-152 aa of BC002952 Sequence: SVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQP Predict reactive species\nFull Name: ADP-ribosylation factor 6\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC002952\nGene Symbol: ARF6\nGene ID (NCBI): 382\nRRID: AB_3670454\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P62330\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888099545257,"sku":"68924-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68924-1-ig","provider":"Iright","version":"1.0","type":"link"}