{"product_id":"proteintech-68969-4-ig","title":"Proteintech, 68969-4-Ig, Claudin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 1 (68969-4-Ig) by Proteintech is a Monoclonal antibody targeting Claudin 1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n68969-4-Ig targets Claudin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ACHN cells, pig skin tissue,  Caki-1 cells,  HaCaT cells,  HepG2 cells,  HT-1376 cells,  rat skin tissue,  mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa))  proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29478 Product name: Recombinant human Claudin 1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species\nFull Name: claudin 1\nCalculated Molecular Weight: 211 aa, 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC012471\nGene Symbol: Claudin 1\nGene ID (NCBI): 9076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O95832\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888109637801,"sku":"68969-4-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-68969-4-ig","provider":"Iright","version":"1.0","type":"link"}