{"product_id":"proteintech-80165-1-rr","title":"Proteintech, 80165-1-RR, TMEM173\/STING Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM173\/STING (80165-1-RR) by Proteintech is a Recombinant antibody targeting TMEM173\/STING in WB, IHC, IF\/ICC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human samples\n80165-1-RR targets TMEM173\/STING in WB, IHC, IF\/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MOLT-4 cells,  Jurkat cells,  K-562 cells,  THP-1 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human tonsillitis tissue, human colon tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\nPositive IF-Fro detected in: mouse cerebellum tissue\nPositive IF\/ICC detected in: THP-1 cells, human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species\nFull Name: transmembrane protein 173\nCalculated Molecular Weight: 379 aa, 42 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC047779\nGene Symbol: STING\nGene ID (NCBI): 340061\nRRID: AB_2918870\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86WV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888346550441,"sku":"80165-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-80165-1-rr","provider":"Iright","version":"1.0","type":"link"}