{"product_id":"proteintech-80545-1-rr","title":"Proteintech, 80545-1-RR, Occludin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Occludin (80545-1-RR) by Proteintech is a Recombinant antibody targeting Occludin in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, pig samples\n80545-1-RR targets Occludin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HaCaT cells,  pig colon tissue,  mouse colon tissue,  HUVEC cells,  U2OS cells\nPositive IP detected in: HUVEC cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOccludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels. The monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species\nFull Name: occludin\nCalculated Molecular Weight: 522 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC029886\nGene Symbol: Occludin\nGene ID (NCBI): 4950\nRRID: AB_2918901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888358510761,"sku":"80545-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-80545-1-rr","provider":"Iright","version":"1.0","type":"link"}