{"product_id":"proteintech-80713-1-rr","title":"Proteintech, 80713-1-RR, Beta Tubulin Recombinant monoclonal antibody","description":"Size: 100ul\nThe Beta Tubulin (80713-1-RR) by Proteintech is a Recombinant antibody targeting Beta Tubulin in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, zebrafish samples\n80713-1-RR targets Beta Tubulin in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  zebrafish tissue,  Jurkat cells,  K-562 cells,  Hsc-T6 cells,  NIH\/3T3 cells,  mouse brain,  rat brain\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\nPositive IF\/ICC detected in: C2C12 cells, HeLa cells,  HepG2 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThere are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, zebrafish\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0117 Product name: Recombinant human Tubulin-beta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-259 aa of BC000748 Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP Predict reactive species\nFull Name: tubulin, beta 3\nCalculated Molecular Weight: 450 aa, 50 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC000748\nGene Symbol: TUBB3\nGene ID (NCBI): 10381\nRRID: AB_2918906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13509\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888339472553,"sku":"80713-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-80713-1-rr","provider":"Iright","version":"1.0","type":"link"}