{"product_id":"proteintech-80777-1-rr","title":"Proteintech, 80777-1-RR, G3BP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe G3BP1 (80777-1-RR) by Proteintech is a Recombinant antibody targeting G3BP1 in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n80777-1-RR targets G3BP1 in IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: sodium arsenite treated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species\nFull Name: GTPase activating protein (SH3 domain) binding protein 1\nCalculated Molecular Weight: 466 aa, 52 kDa\nGenBank Accession Number: BC006997\nGene Symbol: G3BP1\nGene ID (NCBI): 10146\nRRID: AB_3086456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13283\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888858484905,"sku":"80777-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-80777-1-rr","provider":"Iright","version":"1.0","type":"link"}