{"product_id":"proteintech-80793-1-rr","title":"Proteintech, 80793-1-RR, Fetuin-A\/AHSG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Fetuin-A\/AHSG (80793-1-RR) by Proteintech is a Recombinant antibody targeting Fetuin-A\/AHSG in WB, ELISA applications with reactivity to human samples\n80793-1-RR targets Fetuin-A\/AHSG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFetuin-A, also named as Alpha2-HS glycoprotein (AHSG), is a member of cystatin superfamily of protease inhibitors. It is a highly expressed glycoprotein in various fetal tissues whereas it is mainly expressed by the liver in adults. Fetuin A, an extracellular inhibitor of transforming growth factor β, is a profibrogenic stimulus in liver disease. Circulating fetuin-A may be a beneficial serum biomarker in the detection of liver and vascular fibrosis progression in patients with non-alcoholic fatty liver disease. It is also involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Fetuin-A exerts its effects on the cardiovascular system by two different mechanisms. On the one hand it inhibits ins signaling and induces ins resistance contributing to the onset of atherosclerosis and on the other hand it inhibits calcium deposition and protects from vascular calcification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9853 Product name: Recombinant human AHSG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-367 aa of BC048198 Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV Predict reactive species\nFull Name: alpha-2-HS-glycoprotein\nCalculated Molecular Weight: 367 aa, 39 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC048198\nGene Symbol: Fetuin-A\nGene ID (NCBI): 197\nRRID: AB_2918913\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02765\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888636416169,"sku":"80793-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-80793-1-rr","provider":"Iright","version":"1.0","type":"link"}