{"product_id":"proteintech-81245-1-rr","title":"Proteintech, 81245-1-RR, EEA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EEA1 (81245-1-RR) by Proteintech is a Recombinant antibody targeting EEA1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n81245-1-RR targets EEA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  HeLa cells,  LNCaP cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEarly endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28814 Product name: Recombinant human EEA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1151-1350 aa of NM_003566 Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA Predict reactive species\nFull Name: early endosome antigen 1\nCalculated Molecular Weight: 162 kDa\nObserved Molecular Weight: 162 kDa\nGenBank Accession Number: NM_003566\nGene Symbol: EEA1\nGene ID (NCBI): 8411\nRRID: AB_2923711\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15075\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888424931497,"sku":"81245-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-81245-1-rr","provider":"Iright","version":"1.0","type":"link"}