{"product_id":"proteintech-81463-1-rr","title":"Proteintech, 81463-1-RR, GLUT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GLUT1 (81463-1-RR) by Proteintech is a Recombinant antibody targeting GLUT1 in WB, IHC, ELISA applications with reactivity to human samples\n81463-1-RR targets GLUT1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled HEK-293 cells, 37°C incubated HeLa cells\nPositive IHC detected in: human skin cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16282 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 1\nCalculated Molecular Weight: 492 aa, 54 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC121804\nGene Symbol: GLUT1\nGene ID (NCBI): 6513\nRRID: AB_2923718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11166\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888530870441,"sku":"81463-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-81463-1-rr","provider":"Iright","version":"1.0","type":"link"}