{"product_id":"proteintech-81468-5-rr","title":"Proteintech, 81468-5-RR, SCD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCD1 (81468-5-RR) by Proteintech is a Recombinant antibody targeting SCD1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n81468-5-RR targets SCD1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HepG2 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species\nFull Name: stearoyl-CoA desaturase (delta-9-desaturase)\nCalculated Molecular Weight: 355 aa, 41 kDa\nObserved Molecular Weight: 28-42 kDa\nGenBank Accession Number: BC005807\nGene Symbol: SCD\nGene ID (NCBI): 6319\nRRID: AB_3670496\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00767\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888819392681,"sku":"81468-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-81468-5-rr","provider":"Iright","version":"1.0","type":"link"}